Host taxon 10090
Protein NP_032363.1
interferon gamma precursor
Mus musculus
Gene Ifng, UniProt P01580
>NP_032363.1|Pseudomona aeruginosa PA01|interferon gamma precursor
MNATHCILALQLFLMAVSGCYCHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 5.52 | 5.5196037755672 | 2.1e-13 | 32071273 | |
Retrieved 1 of 1 entries in 0.5 ms
(Link to these results)