Host taxon 10090
Protein NP_001103968.1
interferon alpha/beta receptor 2 isoform b precursor
Mus musculus
Gene Ifnar2, UniProt O35664
>NP_001103968.1|Pseudomona aeruginosa PA01|interferon alpha/beta receptor 2 isoform b precursor
MRSRCTVSAVGLLSLCLVVSASLETITPSAFDGYPDEPCTINITIRNSRLILSWELENKSGPPANYTLWYTVMSKDENLTKVKNCSDTTKSSCDVTDKWLEGMESYVVAIVIVHRGDLTVCRCSDYIVPANAPLEPPEFEIVGFTDHINVTMEFPPVTSKIIQEKMKTTPFVIKEQIGDSVRKKHEPKVNNVTGNFTFVLRDLLPKTNYCVSLYFDDDPAIKSPLKCIVLQPGQESGMARFLKFALLF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.81 | 0.810385740116084 | 2.1e-12 | 32071273 | |
Retrieved 1 of 3 entries in 1.6 ms
(Link to these results)