Host taxon 10090
Protein NP_032074.3
insulin-like growth factor-binding protein 7 isoform 2 precursor
Mus musculus
Gene Igfbp7, UniProt Q61581
>NP_032074.3|Pseudomona aeruginosa PA01|insulin-like growth factor-binding protein 7 isoform 2 precursor
MMERPPRALLLGAAGLLLLLLPLSSSSSSDACGPCVPASCPALPRLGCPLGETRDACGCCPVCARGEGEPCGGGAAGRGHCAPGMECVKSRKRRKGKAGAAAGGPATLAVCVCKSRYPVCGSNGITYPSGCQLRAASLRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAKVFLSCEVIGIPTPVLIWNKVKRDHSGVQRTELLPGDRENLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASAAAKITVVDALHEIPLKKGEGAQL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.26 | 0.258072935167035 | 0.00045 | 32071273 | |
Retrieved 1 of 3 entries in 0.8 ms
(Link to these results)