Host taxon 10090
Protein NP_080198.2
inosine triphosphate pyrophosphatase isoform 1
Mus musculus
Gene Itpa, UniProt Q9D892
>NP_080198.2|Pseudomona aeruginosa PA01|inosine triphosphate pyrophosphatase isoform 1
MAASLVGKKIVFVTGNAKKLEEVIQILGDNFPCTLEAQKIDLPEYQGEPDEISIQKCREAARQVQGPVLVEDTCLCFNALGGLPGPYIKWFLQKLKPEGLHQLLAGFEDKSAYALCTFALSTGDPSQPVLLFRGQTSGQIVMPRGSRDFGWDPCFQPDGYEQTYAEMPKSEKNTISHRFRALHKLQEYFSVAAGAGDH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.75 | -0.750471781205673 | 0.045 | 32071273 | |
Retrieved 1 of 2 entries in 0.7 ms
(Link to these results)