Host taxon 10090
Protein NP_766213.1
INO80 complex subunit C
Mus musculus
Gene Ino80c, UniProt Q8BHA0
>NP_766213.1|Pseudomona aeruginosa PA01|INO80 complex subunit C
MAAQIPIVAATSTPAVARNSKKRPASPSHNSSGGGYGASKKKKLSASGFAQGVSIEAMNESKMASSELSSGPVEKAAKPLPFKDPNFVHSGHGGAVAGKKNRTWKNLKQILAAERALPWQLNDPNYFSIDAPPSFKPAKKYSDISGLLANYTDPQSKLRFSTVEEFSYIRRLPSDVVTGYLALRKATSIVP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.82 | 0.816088761028167 | 0.00048 | 32071273 | |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)