Host taxon 10090
Protein NP_001299619.1
inactive tyrosine-protein kinase transmembrane receptor ROR1 isoform 2 precursor
Mus musculus
Gene Ror1, UniProt Q9Z139
>NP_001299619.1|Pseudomona aeruginosa PA01|inactive tyrosine-protein kinase transmembrane receptor ROR1 isoform 2 precursor
MHRPRRRGTRPPPLALLAALLLAARGADAQETELSVSAELVPTSSWNTSSEIDKGSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPSIRWFKNDAPVVQEPRRISFRATNYGSRLRIRNLDTTDTGYFQCVATNGKKVVSTTGVLFVKFGPPPTASPGSS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.76 | 0.763989862852718 | 0.0035 | 32071273 | |
Retrieved 1 of 2 entries in 1.7 ms
(Link to these results)