Host taxon 10090
Protein NP_001254725.1
IgA-inducing protein homolog
Mus musculus
Gene Igip, UniProt A0A1B0GR74
>NP_001254725.1|Pseudomona aeruginosa PA01|IgA-inducing protein homolog
MCSYYHMKKRSVLGCNITIFAVMFSHLSAGNSPCGNQATVLCISRLEFVQYQS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.49 | -1.48731820266217 | 0.00013 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)