Bacterial taxon 208964
Protein WP_003120308.1
hypothetical protein
Pseudomona aeruginosa PA01
Gene crfX, UniProt Q9I2W6
>WP_003120308.1|Pseudomona aeruginosa PA01|hypothetical protein
MRMHDPFEESLRDLLKASAPQPDDDARLGRVLKTANRQVGAGDLFSLMGHWLQALMIGINNGSPHLAPVSRISAKNASSADKAE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●●○○ -2.33 | -2.32708887877063 | 1.3e-34 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)