Bacterial taxon 208964
Protein WP_003094362.1
HPr family phosphocarrier protein
Pseudomona aeruginosa PA01
Gene ptsH, UniProt Q9HVV2
>WP_003094362.1|Pseudomona aeruginosa PA01|HPr family phosphocarrier protein
MPALEITIINKLGLHARAAAKFVGVAGRYPCQVRVGRNPESCVDGKSIMAVMMLAAGKGTNLHLHTEGEQEDEALNALVELINNRFDEGE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●○○○ -1.3 | -1.30488660030515 | 1.4e-17 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 2.2 ms
(Link to these results)