Host taxon 10090
Protein NP_001153372.1
homeodomain-only protein
Mus musculus
Gene Hopx, UniProt Q8R1H0
>NP_001153372.1|Pseudomona aeruginosa PA01|homeodomain-only protein
MSAQTASGPTEDQVEILEYNFNKVNKHPDPTTLCLIAAEAGLTEEQTQKWFKQRLAEWRRSEGLPSECRSVTD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.24 | 0.244416007103589 | 0.00081 | 32071273 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)