Host taxon 10090
Protein NP_835586.2
histone H2B type 2-E
Mus musculus
Gene H2bc21, UniProt Q64524
>NP_835586.2|Pseudomona aeruginosa PA01|histone H2B type 2-E
MPELAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIANEASRLAHYNKRSTITSREIQTSVRLLLPGELAKHAVSEGTKAVTKYTSAK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.6 | -2.59925546188463 | 6.2e-7 | 32071273 | |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)