Host taxon 10090
Protein NP_835507.1
histone H2B type 1-M
Mus musculus
Gene H2bc14, UniProt P10854
>NP_835507.1|Pseudomona aeruginosa PA01|histone H2B type 1-M
MPEPTKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.92 | -1.92000610238175 | 0.00087 | 32071273 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)