Host taxon 10090
Protein NP_783593.1
histone H2A type 2-C
Mus musculus
Gene H2ac20, UniProt Q64523
>NP_783593.1|Pseudomona aeruginosa PA01|histone H2A type 2-C
MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHKAKSK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.76 | -1.758082993933 | 3.3e-5 | 32071273 | |
Retrieved 1 of 2 entries in 1.3 ms
(Link to these results)