Host taxon 10090
Protein NP_001171015.1
histone H2A type 1-O
Mus musculus
Gene H2ac6, UniProt C0HKE2
>NP_001171015.1|Pseudomona aeruginosa PA01|histone H2A type 1-O
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● -5.3 | -5.30339773477359 | 0.00094 | 32071273 | |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)