Host taxon 10090
Protein NP_057886.1
hippocalcin-like protein 1
Mus musculus
Gene Hpcal1, UniProt P62748
>NP_057886.1|Pseudomona aeruginosa PA01|hippocalcin-like protein 1
MGKQNSKLRPEVLQDLREHTEFTDHELQEWYKGFLKDCPTGHLTVDEFKKIYANFFPYGDASKFAEHVFRTFDTNSDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISRSEMLEIVQAIYKMVSSVMKMPEDESTPEKRTDKIFRQMDTNNDGKLSLEEFIKGAKSDPSIVRLLQCDPSSASQF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.85 | 0.849515371122462 | 6.6e-17 | 32071273 | |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)