Host taxon 10090
Protein NP_001188320.1
hemoglobin, beta adult s chain
Mus musculus
Gene Hbb-b1, UniProt P02088
>NP_001188320.1|Pseudomona aeruginosa PA01|hemoglobin, beta adult s chain
MVHLTDAEKAAVSGLWGKVNADEVGGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNAKVKAHGKKVITAFNDGLNHLDSLKGTFASLSELHCDKLHVDPENFRLLGNMIVIVLGHHLGKDFTPAAQAAFQKVVAGVAAALAHKYH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.44 | 1.43654624943595 | 1.9e-41 | 32071273 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)