Host taxon 10090
Protein NP_058652.1
hemoglobin subunit beta-2
Mus musculus
Gene Hbb-b2, UniProt P02089
>NP_058652.1|Pseudomona aeruginosa PA01|hemoglobin subunit beta-2
MVHLTDAEKSAVSCLWAKVNPDEVGGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNPKVKAHGKKVITAFNEGLKNLDNLKGTFASLSELHCDKLHVDPENFRLLGNAIVIVLGHHLGKDFTPAAQAAFQKVVAGVATALAHKYH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.79 | 1.78748571783917 | 2.5e-125 | 32071273 | |
Retrieved 1 of 2 entries in 1.2 ms
(Link to these results)