Host taxon 10090
Protein NP_001077424.1
hemoglobin alpha, adult chain 2
Mus musculus
Gene Hba-a1, UniProt Q91VB8
>NP_001077424.1|Pseudomona aeruginosa PA01|hemoglobin alpha, adult chain 2
MVLSGEDKSNIKAAWGKIGGHGAEYGAEALERMFASFPTTKTYFPHFDVSHGSAQVKGHGKKVADALANAAGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPADFTPAVHASLDKFLASVSTVLTSKYR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.42 | 1.42459527528303 | 3.5e-77 | 32071273 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)