Host taxon 10090
Protein NP_062328.3
hematopoietic prostaglandin D synthase
Mus musculus
Gene Hpgds, UniProt Q9JHF7
>NP_062328.3|Pseudomona aeruginosa PA01|hematopoietic prostaglandin D synthase
MPNYKLLYFNMRGRAEIIRYIFAYLDIKYEDHRIEQADWPKIKPTLPFGKIPVLEVEGLTIHQSLAIARYLTKNTDLAGKTALEQCQADAVVDTLDDFMSLFPWAEKDQDLKERMFNELLTHQAPRLLKDLDTYLGDKEWFIGNYVTWADFYWDICSTTLLVLKPGLLDIYPKLVSLRNKVQAIPAISAWILKRPQTKL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.41 | 1.40967517349573 | 0.00017 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)