Host taxon 10090
Protein NP_001012401.1
heat shock protein beta-6 isoform 1
Mus musculus
Gene Hspb6, UniProt Q5EBG6
>NP_001012401.1|Pseudomona aeruginosa PA01|heat shock protein beta-6 isoform 1
MEIPVPVQPSWLRRASAPLPGFSAPGRLFDQRFGEGLLEAELASLCPAAIAPYYLRAPSVALPTAQVSTDSGYFSVLLDVKHFLPEEISVKVVDDHVEVHARHEERPDEHGFIAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQATPASAQAQLPSPPAAK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.02 | 1.01896783097792 | 0.0042 | 32071273 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)