Host taxon 10090
Protein NP_001158180.1
heat shock protein beta-2 isoform 2
Mus musculus
Gene Hspb2, UniProt Q99PR8
>NP_001158180.1|Pseudomona aeruginosa PA01|heat shock protein beta-2 isoform 2
MSGRTVPHAHPATAEYEFANPSRLGEQRFGEDVDPWRVRAALSHDGILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEIARVEP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●○ -3.09 | -3.08506481750394 | 0.014 | 32071273 | |
Retrieved 1 of 2 entries in 1.2 ms
(Link to these results)