Host taxon 10090
Protein NP_001277736.1
HAUS augmin-like complex subunit 2 isoform b
Mus musculus
Gene Haus2, UniProt Q9CQS9
>NP_001277736.1|Pseudomona aeruginosa PA01|HAUS augmin-like complex subunit 2 isoform b
MLDVSKKMAPCFVNFSRLQQISDIQAEIYQNNLELELLKLEKDTADLIHPSHLIEKCDVLQSMNNHLEAVLKEKHAIRQRLLRPMCQENLPLEAVYHRYVVHMLDLAVTFIEKFETHLETVKNSPHLDANLKQMSKALAKMDILVNKTEELAENILKWRELQTEISLYIPKMLTEERHLHELDIVPPLPFFPKAHTETSRAK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.74 | 1.74131467671959 | 4.5e-18 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)