Host taxon 10090
Protein NP_077219.1
haloacid dehalogenase-like hydrolase domain-containing protein 3
Mus musculus
Gene Hdhd3, UniProt Q9CYW4
>NP_077219.1|Pseudomona aeruginosa PA01|haloacid dehalogenase-like hydrolase domain-containing protein 3
MAHRLQMRLLTWDVKDTLIKLRRPVGEEYASKARAHGVVVEDITVEQAFRQAYRAQSHNFPNYGLSRGLTSRQWWKDVVLHTFRLAGVPDAQAMTPVADQLYEDFSSPFTWQVLEGAEMTLKGCRKRGLKLAVVSNFDRRLEDILTGLGLREHFDFVLTSEAVGCPKPDPRIFREALQRACVEPAVAAHVGDSYLCDYQGSQAVGMHSFLVAGSEPLDSAVRDSVPKEHILPSLSHLLPALDLLEASSPMS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.48 | -2.47843913362475 | 7.1e-6 | 32071273 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)