Host taxon 10090
Protein NP_079679.1
H/ACA ribonucleoprotein complex subunit 3
Mus musculus
Gene Nop10, UniProt Q9CQS2
>NP_079679.1|Pseudomona aeruginosa PA01|H/ACA ribonucleoprotein complex subunit 3
MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQPRPVL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.6 | -1.60369214910032 | 2.8e-6 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)