Host taxon 10090
Protein NP_080907.1
H/ACA ribonucleoprotein complex subunit 2 isoform 1
Mus musculus
Gene Nhp2, UniProt Q9CRB2
>NP_080907.1|Pseudomona aeruginosa PA01|H/ACA ribonucleoprotein complex subunit 2 isoform 1
MTKVKAAPEESEAQAEGCSEERTYKELLVNLNPIAQPLASRRLTRKLYKCIKKAVKQKQIRRGVKEVQKFVNKGEKGIMVLAGDTLPIEVYCHLPVLCEDQNLPYVYIPSKTDLGAATGSKRPTCVIMVKPHEEYQETYDKCLEEVQALPTPL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.92 | 0.916348637767855 | 0.0014 | 32071273 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)