Host taxon 10090
Protein NP_080854.1
H/ACA ribonucleoprotein complex subunit 1
Mus musculus
Gene Gar1, UniProt Q9CY66
>NP_080854.1|Pseudomona aeruginosa PA01|H/ACA ribonucleoprotein complex subunit 1
MSFRGGGRGGFNRGGGGGGFNRGGGSNNHFRGGGGGGGGSFRGGGGGGGGSFRGGGRGGFGRGGGRGGFNKFQDQGPPERVVLLGEFMHPCEDDIVCKCTTEENKVPYFNAPVYLENKEQVGKVDEIFGQLRDFYFSVKLSENMKASSFKKLQKFYIDPYKLLPLQRFLPRPPGEKGPPRGGGGGGRGGRGGGRGGGGRGGGRGGGFRGGRGGGGGFRGGRGGGGFRGRGH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.57 | 1.56743922779205 | 0.00022 | 32071273 | |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)