Host taxon 10090
Protein NP_001033753.2
guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2 precursor
Mus musculus
Gene Gngt2, UniProt Q61017
>NP_001033753.2|Pseudomona aeruginosa PA01|guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2 precursor
MAQDLSEKELLRMEVEQLKKEVKNPRDLISKTGKEIKDYVEAQAGTDPLLKGIPEDKNPFKEKGTCVLS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.09 | -2.085621035961 | 1.6e-5 | 32071273 | |
Retrieved 1 of 3 entries in 0.9 ms
(Link to these results)