Host taxon 10090
Protein NP_001033744.1
guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7
Mus musculus
Gene Gng7, UniProt Q3UGN1
>NP_001033744.1|Pseudomona aeruginosa PA01|guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7
MMSGTNNVAQARKLVEQLRIEAGIERIKVSKASSDLMGYCEQHARNDPLLVGVPASENPFKDKKPCIIL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ -2.78 | -2.77942727893603 | 0.0035 | 32071273 | |
Retrieved 1 of 2 entries in 0.6 ms
(Link to these results)