Host taxon 10090
Protein NP_034446.1
guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3 precursor
Mus musculus
Gene Gng3, UniProt P63216
>NP_034446.1|Pseudomona aeruginosa PA01|guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3 precursor
MKGETPVNSTMSIGQARKMVEQLKIEASLCRIKVSKAAADLMTYCDAHACEDPLITPVPTSENPFREKKFFCALL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●○○ 2.54 | 2.54095821524206 | 0.0027 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)