Host taxon 10090
Protein NP_663485.1
guanine nucleotide exchange factor MSS4
Mus musculus
Gene Rabif, UniProt Q91X96
>NP_663485.1|Pseudomona aeruginosa PA01|guanine nucleotide exchange factor MSS4
MEPCELQNELVSAEGRNRKAVLCQRCGSRVLQPGTALFSRRQLFLPSMRKKPDLADGSNPDGDLLQEHWLVNDMFTFENVGFTKDVGNIKFLVCADCEIGPIGWHCLDDKNSFYVALERVSHE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.71 | -0.70555544174516 | 0.045 | 32071273 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)