Host taxon 10090
Protein NP_001152801.1
GTP-binding protein 8 isoform 2
Mus musculus
Gene Gtpbp8, UniProt Q9CY28
>NP_001152801.1|Pseudomona aeruginosa PA01|GTP-binding protein 8 isoform 2
MAAARLSHRMGRLLEKAPALGPWTRVYSTSPAFAEVLRLPQKQLTKVCFIGRSNVGKSSLIKALFSLAPDVEVRISKKPGHTKKMNFFKVGKHFTLVDMPGYGYRAPEDFVDMVETYLKERNNLKRTFLLVDSVVGITKLDNIAIEMCEEFALPYVMILTKIDKSSKGYLLKQVLQIQKFVNTQTQGCFPQLFPISAVTNSGVHLLKCFIADITGSLK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.78 | -1.77948977601659 | 0.0021 | 32071273 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)