Host taxon 10090
Protein NP_001300865.1
growth factor receptor-bound protein 2
Mus musculus
Gene Grb2, UniProt Q60631
>NP_001300865.1|Pseudomona aeruginosa PA01|growth factor receptor-bound protein 2
MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQMPQQPTYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNRNV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.18 | 1.17991510001548 | 4.7e-27 | 32071273 | |
Retrieved 1 of 3 entries in 0.7 ms
(Link to these results)