Host taxon 10090
Protein NP_034099.2
granulocyte-macrophage colony-stimulating factor precursor
Mus musculus
Gene Csf2, UniProt P01587
>NP_034099.2|Pseudomona aeruginosa PA01|granulocyte-macrophage colony-stimulating factor precursor
MWLQNLLFLGIVVYSLSAPTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●●●● 4.99 | 4.98959392596836 | 1.1e-71 | 32071273 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)