Host taxon 10090
Protein NP_080305.2
glyoxalase domain-containing protein 4 isoform 1
Mus musculus
Gene Glod4, UniProt Q9CPV4
>NP_080305.2|Pseudomona aeruginosa PA01|glyoxalase domain-containing protein 4 isoform 1
MATRRALHFVFKVKNRFQTVHFFRDVLGMQVLRHEEFEEGCKAACNGPYDGKWSKTMVGFGPEDDHFVAELTYNYGIGDYKLGNDFMGITLASSQAVSNARKLEWPLSKVAEGIFETEAPGGYKFYLQDRSPSQSDPVLKVTLAVSDLQKSLNYWSNLLGMKIYEQDEEKQRALLGYADNQCKLELQGIQGAVDHAAAFGRIAFSCPQKELPDLEDLMKRESHSILTPLVSLDTPGKATVQVVILADPDGHEICFVGDEAFRELSKMDPKGSKLLDDAMEADKSDEWFATRNKPKASG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.17 | -1.17446680675905 | 5.3e-5 | 32071273 | |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)