Host taxon 10090
Protein NP_001159402.1
glycosyltransferase 8 domain-containing protein 1
Mus musculus
Gene Glt8d1, UniProt Q6NSU3
>NP_001159402.1|Pseudomona aeruginosa PA01|glycosyltransferase 8 domain-containing protein 1
MSFRKVNIIIWVLAVVLFLLVLHHNFLSLSSLLKNDISDSGIVGLQPIDFVASAHQHPVSERQEEIPVVIAASEDRLGGTIAAINSVHQNTRSNVMFYIVTFNSTADHLRSWLNSGSLKSIRYKIVNFDTKLLEGKVKQDPDQGESMKPLTFARFYLPILVPSAKKAIYMDDDVIVQGDILALYNTPLKPGHAAAFSEDCDSASTKVIIRGAGNQYNYIGYLDYKKERIRKLSMKASTCSFNPGVFVANLTEWKRQNVTNQLEKWMKLNVEEGLYSRTLAGSITTPPLLIVFYQQHSTIDPMWNVRHLGSSAGKRYSPQFVKAAKLLHWNGHFKPWGRTASYADVWEKWYIPDPTGKFSLIRRHMDTSNIK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.84 | -1.8393920767229 | 1.1e-7 | 32071273 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)