Bacterial taxon 208964
Protein WP_003114050.1
glycine cleavage system protein GcvH
Pseudomona aeruginosa PA01
Gene gcvH2, UniProt Q9HTX6
>WP_003114050.1|Pseudomona aeruginosa PA01|glycine cleavage system protein GcvH
MSNIPAELRYAQSHEWARLEADGSVTVGISDHAQEALGDVVFIELPELGKTLAAGQEAGVVESVKAASDIYSPIGGEVIAINEALADTPEDVNNDPYVSWFFKLKPSNPAELDKLLDAAGYQAAVDAEG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●○○○○ -0.45 | -0.447923715737669 | 3.5e-7 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)