Bacterial taxon 208964
Protein WP_003089718.1
glycine cleavage system protein GcvH
Pseudomona aeruginosa PA01
Gene gcvH1, UniProt Q9I136
>WP_003089718.1|Pseudomona aeruginosa PA01|glycine cleavage system protein GcvH
MSKLRFTTDHEWLRQDDDGLLTVGITAYAQDALGDVVFVQLPELGEHAAGSEVAVLESVKAASNILMPLDGEVVAINDALPDAPELVNQDPLGEAWFFRFRPADAGAWEKLLDQAAYDRLLNANADA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●○○○ 1.71 | 1.70656913858334 | 2.3e-31 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)