Host taxon 10090
Protein NP_001070821.1
glutathione S-transferase A3 isoform a
Mus musculus
Gene Gsta3, UniProt P30115
>NP_001070821.1|Pseudomona aeruginosa PA01|glutathione S-transferase A3 isoform a
MAGKPVLHYFDGRGRMEPIRWLLAAAGVEFEEKFLKTRDDLARLRSDGSLMFQQVPMVEIDGMKLVQTKAILNYIASKYNLYGKDMKERAIIDMYTEGVADLEIMILYYPHMPPEEKEASLAKIKEQTRNRYFPAFEKVLKSHGQDYLVGNRLSRADIALVELLYHVEELDPGVVDNFPLLKALRSRVSNLPTVKKFLQPGSQRKPFDDAKCVESAKKIFS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.37 | 0.367849957335138 | 0.027 | 32071273 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)