Host taxon 10090
Protein NP_001316789.1
glutathione peroxidase 3 isoform 2 precursor
Mus musculus
Gene Gpx3, UniProt P46412
>NP_001316789.1|Pseudomona aeruginosa PA01|glutathione peroxidase 3 isoform 2 precursor
MARILRASCLLSLLLAGFVPPGRGQEKSKTDCHGGMSGTIYEYGALTIDGEEYIPFKQYAGKYILFVNVASYUGLTDQYLGFLGSPGCPQTCSVDQDGLKLRSACLLNAEIKELNALQEELGPFGLVILGFPSNQFGKQEPGENSEILPSLKYVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTAELLGSPGRLFWEPMKIHDIRWNFEKFLVGPDGIPVMRWYHRTTVSNVKMDILSYMRRQAALSARGK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.46 | 0.456989041889951 | 4.0e-10 | 32071273 | |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)