Host taxon 10090
Protein NP_109602.2
glutathione peroxidase 2
Mus musculus
Gene Gpx2, UniProt Q9JHC0
>NP_109602.2|Pseudomona aeruginosa PA01|glutathione peroxidase 2
MAYIAKSFYDLSAVGLDGEKIDFNTFRGRAVLIENVASLUGTTTRDYNQLNELQCRFPRRLVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGYQPTFSLTQKCDVNGQNEHPVFAYLKDKLPYPYDDPFSLMTDPKLIIWSPVRRSDVSWNFEKFLIGPEGEPFRRYSRSFQTINIEPDIKRLLKVAI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.53 | 1.52875510075272 | 8.3e-15 | 32071273 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)