Host taxon 10090
Protein NP_852075.1
general transcription factor IIH subunit 3
Mus musculus
Gene Gtf2h3, UniProt Q8VD76
>NP_852075.1|Pseudomona aeruginosa PA01|general transcription factor IIH subunit 3
MAADEDELNLLVIIVDTNPIWWGKQALKESQFTLSKCMDAVMVLANSHLFMNRSNQLAVIASHIQESRLLYPGKNGGLGDFFGDPGNALPDCNPSGSKDGKYELLTVANEVIAEEIKDLMTKSDIKGQHTETLLAGSLAKALCYIHRVNKAVKDNQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQNILIDACVLDSDSGLLQQACDITGGLYLKVPQMPSLLQYLLWVFLPDQDQRSQLILPPPIHVDYRAACFCHRSLIEIGYVCSVCLSIFCNFSPICTTCETAFKISLPPVLKAKKKKQKVSL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.45 | -1.44506709578667 | 0.0099 | 32071273 | |
Retrieved 1 of 2 entries in 1.1 ms
(Link to these results)