Host taxon 10090
Protein NP_081465.1
gem-associated protein 7
Mus musculus
Gene Gemin7, UniProt Q9CWY4
>NP_081465.1|Pseudomona aeruginosa PA01|gem-associated protein 7
MQSPLTIPVPVPVLRLPRGPDGFSRGFASDGRRTILRPEVGEGHIQDPPESQEQRARATLRERYLRSLLAMVGHPVSFTLHEGVHVTAQFGATDLDVANFYVSQLQTPIGVQAEALLRCSDIISYSFKL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ -0.82 | -0.824144774338577 | 0.0078 | 32071273 | |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)