Host taxon 10090
Protein NP_065615.1
gamma-aminobutyric acid receptor-associated protein-like 1
Mus musculus
Gene Gabarapl1, UniProt Q8R3R8
>NP_065615.1|Pseudomona aeruginosa PA01|gamma-aminobutyric acid receptor-associated protein-like 1
MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●○○○○ 0.37 | 0.373819470883063 | 0.0042 | 32071273 | |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)