Host taxon 10090
Protein NP_001074212.1
G protein-coupled receptor kinase 4 isoform 2
Mus musculus
Gene Grk4, UniProt O70291
>NP_001074212.1|Pseudomona aeruginosa PA01|G protein-coupled receptor kinase 4 isoform 2
MELENFVANNLLLKARLGFNKQTGRSKKWRELLKFPPVSMCTELRWSIEKDFSSLCDKQPIGRLLFRQFCDTKPDLKRCIEFLDAVAEYEVTIEEEQREFGLAIFSRFFKEKSEVPLPEIPPDIVKECKWNLKQNSPSQNVFEECAGFSVSRVVSLWDPKRTQMPAQAYTQKNSQLP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.89 | -1.8949774567893 | 0.00016 | 32071273 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)