Host taxon 10090
Protein NP_071287.1
FXYD domain-containing ion transport regulator 6 precursor
Mus musculus
Gene Fxyd6, UniProt Q9D164
>NP_071287.1|Pseudomona aeruginosa PA01|FXYD domain-containing ion transport regulator 6 precursor
METVLVLCSLLAPVVLASAAEKEKEKDPFYYDYQTLRIGGLVFAVVLFSVGILLILSRRCKCSFNQKPRAPGDEEAQVENLITTNAAEPQKAEN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.44 | -1.44359684623459 | 0.0045 | 32071273 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)