Host taxon 10090
Protein NP_001104543.1
FXYD domain-containing ion transport regulator 5 isoform a precursor
Mus musculus
Gene Fxyd5, UniProt P97808
>NP_001104543.1|Pseudomona aeruginosa PA01|FXYD domain-containing ion transport regulator 5 isoform a precursor
MSLSSRLCLLTIVALILPSRGQTPKKPTSIFTADQTSATTRDNVPDPDQTSPGVQTTPLIWTREEATGSQTAAQTETQQLTKMATSNPVSDPGPHTSSKKGTPAVSRIEPLSPSKNFMPPSYIEHPLDSNENNPFYYDDTTLRKRGLLVAAVLFITGIIILTSGKCRQLSQFCLNRHR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ 1.08 | 1.07560302233401 | 3.2e-8 | 32071273 | |
Retrieved 1 of 3 entries in 1 ms
(Link to these results)