Host taxon 10090
Protein NP_001300674.1
FUN14 domain-containing protein 1 isoform 2
Mus musculus
Gene Fundc1, UniProt Q9DB70
>NP_001300674.1|Pseudomona aeruginosa PA01|FUN14 domain-containing protein 1 isoform 2
MASRNPPPQDYESDDESYEVLDLTEYARRHHWWNRVFGHSSGPMVEKYSVATQIVMGGVTGWCAGFLFQKVGKLAATAVGGGFLLLQATDFIKQNIVISSGFVGGFLLGLAS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.02 | -1.01848601683878 | 0.00022 | 32071273 | |
Retrieved 1 of 3 entries in 1.3 ms
(Link to these results)