Host taxon 10090
Protein NP_038548.3
fms-related tyrosine kinase 3 ligand precursor
Mus musculus
Gene Flt3l, UniProt A9QW46
>NP_038548.3|Pseudomona aeruginosa PA01|fms-related tyrosine kinase 3 ligand precursor
MTVLAPAWSPNSSLLLLLLLLSPCLRGTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPRSPIALEATELPEPRPRQLLLLLLLLLPLTLVLLAAAWGLRWQRARRRGELHPGVPLPSHP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | infected host | Lung tissue | 16 h | ●●○○○ -1.82 | -1.82358815886662 | 1.3e-7 | 32071273 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)