Bacterial taxon 208964
Protein WP_003102044.1
flagellar motor stator protein MotA
Pseudomona aeruginosa PA01
Gene motA, UniProt Q9HUL1
>WP_003102044.1|Pseudomona aeruginosa PA01|flagellar motor stator protein MotA
MSKIIGIIVVFASVLGGFLLSGGKIGAIIQPFEVLIIGGAALGAFLQSNPGSTFMVVLKKAPKMFSNRFTQTYYLEVLGMLYEILNKSRREGMMAIEADIEDPAASPIFSKYPGVLKDERMTAYVCDYLRIMSSGNMAPHELEGLFDMELSSLKEDLEHPSHAVTKVADALPGFGIVAAVLGIVITMALLGEGSQAEIGHHVAAALVGTFLGILAAYGFVGPLAGALEHDAKEELNLFEAIKACLVASASGMPPSLAVEFGRKVLLPAHRPTFAELEQAVRGR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●●○○○ -1.12 | -1.12192108279337 | 1.6e-45 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)