Bacterial taxon 208964
Protein WP_003082150.1
flagellar basal body rod protein FlgC
Pseudomona aeruginosa PA01
Gene flgC, UniProt Q9I4Q1
>WP_003082150.1|Pseudomona aeruginosa PA01|flagellar basal body rod protein FlgC
MSLASVFNIAGSGMSAQSTRLNTVASNIANAETVSSSVDKTYRARHPVFSTMFQQAQGDSGSLFADQDSSGAGVQVLGIVEDQSSLMPRYEPNHPAADANGYVYYPNVNVVEEMADMISASRAFQTNAEMMNTAKQMMQKVLTLGQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Pseudomona aeruginosa PA01 | 208964 | pathogen | Lung tissue | 16 h | ●○○○○ 0.48 | 0.480212481551342 | 0.00028 | 32071273 | Bacterial control measured at 37ºC |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)